Lineage for d1fjfo_ (1fjf O:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46191Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 46192Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 46199Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 46200Protein Ribosomal protein S15 [47065] (2 species)
  7. 46203Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)
  8. 46206Domain d1fjfo_: 1fjf O: [16387]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfo_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1fjfo_:

Click to download the PDB-style file with coordinates for d1fjfo_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfo_: