Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Murine norovirus 1 [TaxId:223997] [372678] (13 PDB entries) |
Domain d6h6lb_: 6h6l B: [411196] Other proteins in same PDB: d6h6le_, d6h6lf_, d6h6lg_, d6h6lh_ automated match to d5or7a_ complexed with cho, edo, mg, na |
PDB Entry: 6h6l (more details), 2.5 Å
SCOPe Domain Sequences for d6h6lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h6lb_ b.121.4.0 (B:) automated matches {Murine norovirus 1 [TaxId: 223997]} rmvdlpviqprlctharwpapvygllvdpslpsnpqwqngrvhvdgtllgttpisgswvs cfaaeaaykfqsgtgevatftlieqdgsayvpgdraaplgypdfsgqleievqtettktg dklkvttfemilgpttnadqapyqgrvfasvtaaasldlvdgrvravprsiygfqdtipe yndgllvplappigpflpgevllrfrtymrqidtadaaaeaidcalpqefvswfasnaft vqsealllryrntltgqllfecklynegyialsysgsgpltfptdgifevvswvprlyql asv
Timeline for d6h6lb_: