PDB entry 6h6l

View 6h6l on RCSB PDB site
Description: Murine norovirus protruding domain (CW3 strain) in complex with the CD300lf receptor and glycochenodeoxycholate (GCDCA)
Class: viral protein
Keywords: MNV1, sCD300lf, GCDCA, bile acid, glycochenodeoxycholate, viral protein
Deposited on 2018-07-27, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: capsid protein
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: capsid protein
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h6le_
  • Chain 'F':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h6lf_
  • Chain 'G':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h6lg_
  • Chain 'H':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h6lh_
  • Heterogens: MG, CHO, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h6lE (E:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6lE (E:)
    dpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkknr
    vsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6h6lF (F:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6lF (F:)
    dpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkknr
    vsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6h6lG (G:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6lG (G:)
    dpvtgpeevsltvqcrytykkywcqgvpqrscktlvetdaseqlvkknrvsirdftvtme
    dlrmsdagiywcgitkggldpmfkvtvn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6h6lH (H:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6lH (H:)
    dpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkknr
    vsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp