SCOPe 2.08: Domain d6h6lg_: 6h6l G:

Lineage for d6h6lg_ (6h6l G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6h6lg_: 6h6l G: [372884]
   Other proteins in same PDB: d6h6la_, d6h6lb_, d6h6lc_, d6h6ld_
   automated match to d5ffla_
   complexed with cho, edo, mg, na

Details for d6h6lg_

PDB Entry: 6h6l, 2.5 Å

PDB Description: murine norovirus protruding domain (cw3 strain) in complex with the cd300lf receptor and glycochenodeoxycholate (gcdca)

PDB Compounds: (G:) CMRF35-like molecule 1

SCOPe Domain Sequences for d6h6lg_:

Sequence, based on SEQRES records:

>d6h6lg_ b.1.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkknr
vsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvn

Sequence, based on observed residues (ATOM records):

>d6h6lg_ b.1.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dpvtgpeevsltvqcrytykkywcqgvpqrscktlvetdaseqlvkknrvsirdftvtme
dlrmsdagiywcgitkggldpmfkvtvn

Timeline for d6h6lg_:

• d6h6lg_ first appeared in SCOPe 2.07