Lineage for d4f58j_ (4f58 J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742654Domain d4f58j_: 4f58 J: [408911]
    Other proteins in same PDB: d4f58l1, d4f58l2, d4f58m1, d4f58m2, d4f58n1, d4f58n2, d4f58o1, d4f58o2
    automated match to d6shgh_
    complexed with so4

Details for d4f58j_

PDB Entry: 4f58 (more details), 2.49 Å

PDB Description: Fab structure of a neutralizing antibody L3 from an early subtype A HIV-1 infected patient
PDB Compounds: (J:) Heavy chain of Fab of a neutralizing antibody L3

SCOPe Domain Sequences for d4f58j_:

Sequence, based on SEQRES records: (download)

>d4f58j_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpggslrlscvasgfsfsdfgmnwvrqapgkglewvafvpfdrrinyy
aesvrgrftisrddskntvflqmdslrpedtaiyycakhrsqwnfwpreggldhwgqgtl
vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d4f58j_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpggslrlscvasgfsfsdfgmnwvrqapgkglewvafvpfdrrinyy
aesvrgrftisrddskntvflqmdslrpedtaiyycakhrsqwnfwpreggldhwgqgtl
vtvssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d4f58j_:

Click to download the PDB-style file with coordinates for d4f58j_.
(The format of our PDB-style files is described here.)

Timeline for d4f58j_:

  • d4f58j_ is new in SCOPe 2.08-stable