Lineage for d6shgh_ (6shg H:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) 
Domain d6shgh_: 6shg H: [389383]
Other proteins in same PDB: d6shgl_
automated match to d3ab0b_
Details for d6shgh_
PDB Entry: 6shg (more details), 3.35 Å
PDB Description: diffraction data for roab13 crystal co-crystallised with piydin and its roab13 structure
PDB Compounds: (H:) Antibody RoAb13 Heavy ChainSCOPe Domain Sequences for d6shgh_:
Sequence, based on SEQRES records: (download)
>d6shgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesggglvkpggslklscaasgftfstyamswvrqtpekrlewvasistgdntyyt
dsvrgrftisrdnarnilylqmsslrsedtamyfctrgrgdrgdlfgywgqgtlvtvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik
Sequence, based on observed residues (ATOM records): (download)
>d6shgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesggglvkpggslklscaasgftfstyamswvrqtpekrlewvasistgdntyyt
dsvrgrftisrdnarnilylqmsslrsedtamyfctrgrgdrgdlfgywgqgtlvtvssa
kttapsvyplapgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
vtvtsstwpsqsitcnvahpasstkvdkkieprgptik
SCOPe Domain Coordinates for d6shgh_:
Click to download the PDB-style file with coordinates for d6shgh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6shgh_:
- d6shgh_ first appeared in SCOPe 2.07
View in 3D
