|  | Class b: All beta proteins [48724] (178 folds) | 
|  | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands | 
|  | Superfamily b.1.1: Immunoglobulin [48726] (5 families)  | 
|  | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) | 
|  | Protein automated matches [190119] (22 species) not a true protein | 
|  | Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) | 
|  | Domain d6shgh_: 6shg H: [389383] Other proteins in same PDB: d6shga_, d6shgl_ automated match to d3ab0b_ | 
PDB Entry: 6shg (more details), 3.09 Å
SCOPe Domain Sequences for d6shgh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6shgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesggglvkpggslklscaasgftfstyamswvrqtpekrlewvasistgdntyyt
dsvrgrftisrdnarnilylqmsslrsedtamyfctrgrgdrgdlfgywgqgtlvtvss
Timeline for d6shgh_: