![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
![]() | Domain d6shga_: 6shg A: [389392] Other proteins in same PDB: d6shgh_ automated match to d4q9ca_ |
PDB Entry: 6shg (more details), 3.09 Å
SCOPe Domain Sequences for d6shga_:
Sequence, based on SEQRES records: (download)
>d6shga_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnr
>d6shga_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkerqngvlnswtdqdskdstys msstltltkdeyerhnsytceathktstspivksfnr
Timeline for d6shga_: