Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d4f58i_: 4f58 I: [408910] Other proteins in same PDB: d4f58l1, d4f58l2, d4f58m1, d4f58m2, d4f58n1, d4f58n2, d4f58o1, d4f58o2 automated match to d6shgh_ complexed with so4 |
PDB Entry: 4f58 (more details), 2.49 Å
SCOPe Domain Sequences for d4f58i_:
Sequence, based on SEQRES records: (download)
>d4f58i_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpggslrlscvasgfsfsdfgmnwvrqapgkglewvafvpfdrrinyy aesvrgrftisrddskntvflqmdslrpedtaiyycakhrsqwnfwpreggldhwgqgtl vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
>d4f58i_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpggslrlscvasgfsfsdfgmnwvrqapgkglewvafvpfdrrinyy aesvrgrftisrddskntvflqmdslrpedtaiyycakhrsqwnfwpreggldhwgqgtl vtvssastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d4f58i_: