| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4f58n2: 4f58 N:109-209 [221033] Other proteins in same PDB: d4f58h_, d4f58i_, d4f58j_, d4f58k_, d4f58l1, d4f58m1, d4f58n1, d4f58o1 automated match to d1q1jl2 complexed with so4 |
PDB Entry: 4f58 (more details), 2.49 Å
SCOPe Domain Sequences for d4f58n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f58n2 b.1.1.2 (N:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d4f58n2: