Lineage for d4f58n1 (4f58 N:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755899Domain d4f58n1: 4f58 N:1-108 [221032]
    Other proteins in same PDB: d4f58h_, d4f58i_, d4f58j_, d4f58k_, d4f58l2, d4f58m2, d4f58n2, d4f58o2
    automated match to d1q1jl1
    complexed with so4

Details for d4f58n1

PDB Entry: 4f58 (more details), 2.49 Å

PDB Description: Fab structure of a neutralizing antibody L3 from an early subtype A HIV-1 infected patient
PDB Compounds: (N:) Light chain of Fab of a neutralizing antibody L3

SCOPe Domain Sequences for d4f58n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f58n1 b.1.1.0 (N:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrq

SCOPe Domain Coordinates for d4f58n1:

Click to download the PDB-style file with coordinates for d4f58n1.
(The format of our PDB-style files is described here.)

Timeline for d4f58n1: