SCOPe 2.08: Domain d4f58m1: 4f58 M:1-108

Lineage for d4f58m1 (4f58 M:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4f58m1: 4f58 M:1-108 [221030]
   Other proteins in same PDB: d4f58h_, d4f58i_, d4f58j_, d4f58k_, d4f58l2, d4f58m2, d4f58n2, d4f58o2
   automated match to d1q1jl1
   complexed with so4

Details for d4f58m1

PDB Entry: 4f58, 2.49 Å

PDB Description: Fab structure of a neutralizing antibody L3 from an early subtype A HIV-1 infected patient

PDB Compounds: (M:) Light chain of Fab of a neutralizing antibody L3

SCOPe Domain Sequences for d4f58m1:

Sequence; same for both SEQRES and ATOM records:

>d4f58m1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrq

Timeline for d4f58m1:

• d4f58m1 first appeared in SCOPe 2.03
  
• d4f58m1 appears in SCOPe 2.07