Lineage for d2fjfk_ (2fjf K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742848Domain d2fjfk_: 2fjf K: [408061]
    Other proteins in same PDB: d2fjfa1, d2fjfa2, d2fjfc1, d2fjfc2, d2fjfe1, d2fjfe2, d2fjfg1, d2fjfg2, d2fjfj1, d2fjfj2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfo1, d2fjfo2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2
    automated match to d6shgh_

Details for d2fjfk_

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (K:) Heavy Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfk_:

Sequence, based on SEQRES records: (download)

>d2fjfk_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2fjfk_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d2fjfk_:

Click to download the PDB-style file with coordinates for d2fjfk_.
(The format of our PDB-style files is described here.)

Timeline for d2fjfk_:

  • d2fjfk_ is new in SCOPe 2.08-stable