Lineage for d2fjfl1 (2fjf L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756584Domain d2fjfl1: 2fjf L:1-107 [197900]
    Other proteins in same PDB: d2fjfa2, d2fjfb_, d2fjfc2, d2fjfd_, d2fjfe2, d2fjff_, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj2, d2fjfk_, d2fjfl2, d2fjfm2, d2fjfn_, d2fjfo2, d2fjfp_, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs2, d2fjft1, d2fjft2, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw2, d2fjfx1, d2fjfx2
    automated match to d1rhha1

Details for d2fjfl1

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (L:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjfl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik

SCOPe Domain Coordinates for d2fjfl1:

Click to download the PDB-style file with coordinates for d2fjfl1.
(The format of our PDB-style files is described here.)

Timeline for d2fjfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjfl2