SCOPe 2.08: Domain d2fjfj2: 2fjf J:108-211

Lineage for d2fjfj2 (2fjf J:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2fjfj2: 2fjf J:108-211 [197899]
   Other proteins in same PDB: d2fjfa1, d2fjfb_, d2fjfc1, d2fjfd_, d2fjfe1, d2fjff_, d2fjfg1, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfk_, d2fjfl1, d2fjfm1, d2fjfn_, d2fjfo1, d2fjfp_, d2fjfq1, d2fjfr1, d2fjfr2, d2fjfs1, d2fjft1, d2fjft2, d2fjfu1, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfx1, d2fjfx2
   automated match to d1rhha2

Details for d2fjfj2

PDB Entry: 2fjf, 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab

PDB Compounds: (J:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfj2:

Sequence; same for both SEQRES and ATOM records:

>d2fjfj2 b.1.1.2 (J:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2fjfj2:

• d2fjfj2 first appeared in SCOPe 2.03
  
• d2fjfj2 appears in SCOPe 2.07