Lineage for d2fjfq2 (2fjf Q:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750940Domain d2fjfq2: 2fjf Q:108-211 [197907]
    Other proteins in same PDB: d2fjfa1, d2fjfb_, d2fjfc1, d2fjfd_, d2fjfe1, d2fjff_, d2fjfg1, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfk_, d2fjfl1, d2fjfm1, d2fjfn_, d2fjfo1, d2fjfp_, d2fjfq1, d2fjfr1, d2fjfr2, d2fjfs1, d2fjft1, d2fjft2, d2fjfu1, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfx1, d2fjfx2
    automated match to d1rhha2

Details for d2fjfq2

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (Q:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjfq2 b.1.1.2 (Q:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2fjfq2:

Click to download the PDB-style file with coordinates for d2fjfq2.
(The format of our PDB-style files is described here.)

Timeline for d2fjfq2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjfq1