![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d2fjfm2: 2fjf M:108-211 [197903] Other proteins in same PDB: d2fjfa1, d2fjfb_, d2fjfc1, d2fjfd_, d2fjfe1, d2fjff_, d2fjfg1, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfk_, d2fjfl1, d2fjfm1, d2fjfn_, d2fjfo1, d2fjfp_, d2fjfq1, d2fjfr1, d2fjfr2, d2fjfs1, d2fjft1, d2fjft2, d2fjfu1, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfx1, d2fjfx2 automated match to d1rhha2 |
PDB Entry: 2fjf (more details), 2.65 Å
SCOPe Domain Sequences for d2fjfm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjfm2 b.1.1.2 (M:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2fjfm2:
![]() Domains from other chains: (mouse over for more information) d2fjfa1, d2fjfa2, d2fjfb_, d2fjfc1, d2fjfc2, d2fjfd_, d2fjfe1, d2fjfe2, d2fjff_, d2fjfg1, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfj2, d2fjfk_, d2fjfl1, d2fjfl2, d2fjfn_, d2fjfo1, d2fjfo2, d2fjfp_, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2 |