Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d2fjfw1: 2fjf W:1-107 [197912] Other proteins in same PDB: d2fjfa2, d2fjfb_, d2fjfc2, d2fjfd_, d2fjfe2, d2fjff_, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj2, d2fjfk_, d2fjfl2, d2fjfm2, d2fjfn_, d2fjfo2, d2fjfp_, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs2, d2fjft1, d2fjft2, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw2, d2fjfx1, d2fjfx2 automated match to d1rhha1 |
PDB Entry: 2fjf (more details), 2.65 Å
SCOPe Domain Sequences for d2fjfw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjfw1 b.1.1.0 (W:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik
Timeline for d2fjfw1:
View in 3D Domains from other chains: (mouse over for more information) d2fjfa1, d2fjfa2, d2fjfb_, d2fjfc1, d2fjfc2, d2fjfd_, d2fjfe1, d2fjfe2, d2fjff_, d2fjfg1, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfj2, d2fjfk_, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn_, d2fjfo1, d2fjfo2, d2fjfp_, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfx1, d2fjfx2 |