Lineage for d7b7uh_ (7b7u H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790698Species Sus scrofa [TaxId:9825] [404428] (1 PDB entry)
  8. 2790699Domain d7b7uh_: 7b7u H: [404429]
    Other proteins in same PDB: d7b7uf_, d7b7ui1, d7b7ui2, d7b7uj_, d7b7uk_, d7b7ul_
    automated match to d2f3ia_
    protein/RNA complex; complexed with zn

Details for d7b7uh_

PDB Entry: 7b7u (more details), 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d7b7uh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7uh_ b.40.4.0 (H:) automated matches {Sus scrofa [TaxId: 9825]}
agilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvia
stlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsyggl
lmrlqgdannlhgfevdsrvyllmkkla

SCOPe Domain Coordinates for d7b7uh_:

Click to download the PDB-style file with coordinates for d7b7uh_.
(The format of our PDB-style files is described here.)

Timeline for d7b7uh_: