PDB entry 7b7u

View 7b7u on RCSB PDB site
Description: Cryo-EM structure of mammalian RNA polymerase II in complex with human RPAP2
Class: transcription
Keywords: RPAP2, RNA polymerase II, Nuclear import, TRANSCRIPTION
Deposited on 2020-12-11, released 2021-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3LJR4
      • insertion (486)
      • conflict (487-488)
      • insertion (499)
      • conflict (500-501)
      • insertion (503)
      • insertion (506-507)
      • conflict (508-509)
      • insertion (511-518)
      • insertion (1300-1303)
      • insertion (1305-1309)
      • conflict (1310-1312)
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II subunit RPB3
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerase II subunit E
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA-directed RNA polymerase II subunit F
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7b7uf_
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC3
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7b7uh_
  • Chain 'I':
    Compound: DNA-directed RNA polymerase II subunit RPB9
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7b7ui1, d7b7ui2
  • Chain 'J':
    Compound: Uncharacterized protein
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed):
    • PDB 7B7U (0-66)
    Domains in SCOPe 2.08: d7b7uj_
  • Chain 'K':
    Compound: RNA_pol_L_2 domain-containing protein
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7b7uk_
  • Chain 'L':
    Compound: RNA polymerase II subunit K
    Species: Sus scrofa domesticus [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7b7ul_
  • Chain 'M':
    Compound: Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
    Species: Homo sapiens [TaxId:9606]
    Gene: RPAP2, C1orf82
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: unknown
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7B7U (0-29)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >7b7uF (F:)
    msdnednfdgddfddveedeglddlenaeeegqenveilpsgerpqanqkrittpymtky
    erarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirrylpdgsyedwgv
    deliisd
    

    Sequence, based on observed residues (ATOM records): (download)
    >7b7uF (F:)
    krittpymtkyerarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirry
    lpdgsyedwgvdeliisd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >7b7uH (H:)
    magilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvi
    astlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsygg
    llmrlqgdannlhgfevdsrvyllmkklaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >7b7uH (H:)
    agilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvia
    stlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsyggl
    lmrlqgdannlhgfevdsrvyllmkkla
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >7b7uI (I:)
    mepdgtyepgfvgirfcqecnnmlypkedkenrillyacrncdyqqeadnsciyvnkith
    evdeltqiiadvsqdptlprtedhpcqkcghkeavffqshsaraedamrlyyvctaphcg
    hrwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >7b7uI (I:)
    fvgirfcqecnnmlypkedkenrillyacrncdyqqeadnsciyvnkithevdeltqiia
    dvsqdptlprtedhpcqkcghkeavffqshsaraedamrlyyvctaphcghrwte
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7b7uJ (J:)
    miipvrcftcgkivgnkweaylgllqaeytegdaldalglkryccrrmllahvdliekll
    nyaplek
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >7b7uK (K:)
    mnappafesfllfegekkitinkdtkvpnaclftinkedhtlgniiksqllkdpqvlfag
    ykvphplehkiiirvqttpdyspqeaftnaitdliselslleerfrvaikdkqegie
    

    Sequence, based on observed residues (ATOM records): (download)
    >7b7uK (K:)
    mnappafesfllfegekkitinkdtkvpnaclftinkedhtlgniiksqllkdpqvlfag
    ykvphplehkiiirvqttpdyspqeaftnaitdliselslleerfrvaikdkqeg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >7b7uL (L:)
    mdtqkdvqppkqqpmiyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar
    

    Sequence, based on observed residues (ATOM records): (download)
    >7b7uL (L:)
    miyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.