Lineage for d7b7uj_ (7b7u J:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. Protein automated matches [190336] (6 species)
    not a true protein
  7. Species Sus scrofa [TaxId:9825] [404546] (1 PDB entry)
  8. Domain d7b7uj_: 7b7u J: [404547]
    Other proteins in same PDB: d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uk_, d7b7ul_
    automated match to d4c2mj_
    protein/RNA complex; complexed with zn

Details for d7b7uj_

PDB Entry: 7b7u (more details), 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2
PDB Compounds: (J:) Uncharacterized protein

SCOPe Domain Sequences for d7b7uj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7uj_ a.4.11.1 (J:) automated matches {Sus scrofa [TaxId: 9825]}
miipvrcftcgkivgnkweaylgllqaeytegdaldalglkryccrrmllahvdliekll
nyaplek

SCOPe Domain Coordinates for d7b7uj_ are not available.

Timeline for d7b7uj_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uk_, d7b7ul_