Lineage for d2f3ia_ (2f3i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790509Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2790547Domain d2f3ia_: 2f3i A: [241805]
    automated match to d1twfh_

Details for d2f3ia_

PDB Entry: 2f3i (more details)

PDB Description: solution structure of a subunit of rna polymerase ii
PDB Compounds: (A:) DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide

SCOPe Domain Sequences for d2f3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
magilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvi
astlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsygg
llmrlqgdannlhgfevdsrvyllmkklaf

SCOPe Domain Coordinates for d2f3ia_:

Click to download the PDB-style file with coordinates for d2f3ia_.
(The format of our PDB-style files is described here.)

Timeline for d2f3ia_: