Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
Domain d2f3ia_: 2f3i A: [241805] automated match to d1twfh_ |
PDB Entry: 2f3i (more details)
SCOPe Domain Sequences for d2f3ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} magilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvi astlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsygg llmrlqgdannlhgfevdsrvyllmkklaf
Timeline for d2f3ia_: