Lineage for d7b7uk_ (7b7u K:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. Family d.74.3.0: automated matches [254324] (1 protein)
    not a true family
  6. Protein automated matches [254742] (3 species)
    not a true protein
  7. Species Sus scrofa [TaxId:9825] [404454] (2 PDB entries)
  8. Domain d7b7uk_: 7b7u K: [404455]
    Other proteins in same PDB: d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uj_, d7b7ul_
    automated match to d1twfk_
    protein/RNA complex; complexed with zn

Details for d7b7uk_

PDB Entry: 7b7u (more details), 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2
PDB Compounds: (K:) RNA_pol_L_2 domain-containing protein

SCOPe Domain Sequences for d7b7uk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7uk_ d.74.3.0 (K:) automated matches {Sus scrofa [TaxId: 9825]}
mnappafesfllfegekkitinkdtkvpnaclftinkedhtlgniiksqllkdpqvlfag
ykvphplehkiiirvqttpdyspqeaftnaitdliselslleerfrvaikdkqeg

SCOPe Domain Coordinates for d7b7uk_ are not available.

Timeline for d7b7uk_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uj_, d7b7ul_