SCOPe 2.08: Domain d7b7uf_: 7b7u F:

Lineage for d7b7uf_ (7b7u F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein automated matches [254699] (5 species)
   not a true protein

7. Species Sus scrofa [TaxId:9825] [404498] (1 PDB entry)

8. Domain d7b7uf_: 7b7u F: [404499]
   Other proteins in same PDB: d7b7uh_, d7b7ui1, d7b7ui2, d7b7uj_, d7b7uk_, d7b7ul_
   automated match to d2nvqf_
   protein/RNA complex; complexed with zn

Details for d7b7uf_

PDB Entry: 7b7u, 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2

PDB Compounds: (F:) DNA-directed RNA polymerase II subunit F

SCOPe Domain Sequences for d7b7uf_:

Sequence; same for both SEQRES and ATOM records:

>d7b7uf_ a.143.1.2 (F:) automated matches {Sus scrofa [TaxId: 9825]}
krittpymtkyerarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirry
lpdgsyedwgvdeliisd

Timeline for d7b7uf_:

• d7b7uf_ first appeared in SCOPe 2.07