Lineage for d7b7ul_ (7b7u L:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. Family g.41.9.0: automated matches [191622] (1 protein)
    not a true family
  6. Protein automated matches [191140] (5 species)
    not a true protein
  7. Species Sus scrofa [TaxId:9825] [404484] (1 PDB entry)
  8. Domain d7b7ul_: 7b7u L: [404485]
    Other proteins in same PDB: d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uj_, d7b7uk_
    automated match to d1twfl_
    protein/RNA complex; complexed with zn

Details for d7b7ul_

PDB Entry: 7b7u (more details), 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2
PDB Compounds: (L:) RNA polymerase II subunit K

SCOPe Domain Sequences for d7b7ul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7ul_ g.41.9.0 (L:) automated matches {Sus scrofa [TaxId: 9825]}
miyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar

SCOPe Domain Coordinates for d7b7ul_ are not available.

Timeline for d7b7ul_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uj_, d7b7uk_