SCOPe 2.08: Domain d7bpkb1: 7bpk B:1-303

Lineage for d7bpkb1 (7bpk B:1-303)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (11 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317278] (7 PDB entries)

8. Domain d7bpkb1: 7bpk B:1-303 [401699]
   Other proteins in same PDB: d7bpka2, d7bpka3, d7bpkb2, d7bpkb3, d7bpkc_, d7bpkd_, d7bpkh_, d7bpkl_
   automated match to d4gsxa1
   mutant

Details for d7bpkb1

PDB Entry: 7bpk, 3.1 Å

PDB Description: zika virus envelope protein mutant bound to mab

PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d7bpkb1:

Sequence; same for both SEQRES and ATOM records:

>d7bpkb1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvnrgwgtgclewgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

Timeline for d7bpkb1:

• d7bpkb1 first appeared in SCOPe 2.07