Lineage for d7bpkb1 (7bpk B:1-303)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628446Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2628447Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2628492Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2628493Protein automated matches [227047] (11 species)
    not a true protein
  7. 2628539Species Zika virus [TaxId:64320] [317278] (7 PDB entries)
  8. 2628547Domain d7bpkb1: 7bpk B:1-303 [401699]
    Other proteins in same PDB: d7bpka2, d7bpka3, d7bpkb2, d7bpkb3, d7bpkc_, d7bpkd_, d7bpkh_, d7bpkl_
    automated match to d4gsxa1
    mutant

Details for d7bpkb1

PDB Entry: 7bpk (more details), 3.1 Å

PDB Description: zika virus envelope protein mutant bound to mab
PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d7bpkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bpkb1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvnrgwgtgclewgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

SCOPe Domain Coordinates for d7bpkb1:

Click to download the PDB-style file with coordinates for d7bpkb1.
(The format of our PDB-style files is described here.)

Timeline for d7bpkb1: