Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Zika virus [TaxId:64320] [317278] (7 PDB entries) |
Domain d7bpkb1: 7bpk B:1-303 [401699] Other proteins in same PDB: d7bpka2, d7bpka3, d7bpkb2, d7bpkb3, d7bpkc_, d7bpkd_, d7bpkh_, d7bpkl_ automated match to d4gsxa1 mutant |
PDB Entry: 7bpk (more details), 3.1 Å
SCOPe Domain Sequences for d7bpkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bpkb1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvnrgwgtgclewgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl kgv
Timeline for d7bpkb1: