![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
![]() | Domain d7bpkc_: 7bpk C: [401904] Other proteins in same PDB: d7bpka1, d7bpka2, d7bpka3, d7bpkb1, d7bpkb2, d7bpkb3, d7bpkd_, d7bpkl_ automated match to d1dqlh_ mutant |
PDB Entry: 7bpk (more details), 3.1 Å
SCOPe Domain Sequences for d7bpkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bpkc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg tlvtvss
Timeline for d7bpkc_: