Lineage for d7bpkc_ (7bpk C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355632Domain d7bpkc_: 7bpk C: [401904]
    Other proteins in same PDB: d7bpka1, d7bpka2, d7bpka3, d7bpkb1, d7bpkb2, d7bpkb3, d7bpkd_, d7bpkl_
    automated match to d1dqlh_
    mutant

Details for d7bpkc_

PDB Entry: 7bpk (more details), 3.1 Å

PDB Description: zika virus envelope protein mutant bound to mab
PDB Compounds: (C:) Z3L1 Heavy chain

SCOPe Domain Sequences for d7bpkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bpkc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg
tlvtvss

SCOPe Domain Coordinates for d7bpkc_:

Click to download the PDB-style file with coordinates for d7bpkc_.
(The format of our PDB-style files is described here.)

Timeline for d7bpkc_: