Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d7bpkd_: 7bpk D: [401791] Other proteins in same PDB: d7bpka1, d7bpka2, d7bpka3, d7bpkb1, d7bpkb2, d7bpkb3, d7bpkc_, d7bpkh_ automated match to d5t93a_ mutant |
PDB Entry: 7bpk (more details), 3.1 Å
SCOPe Domain Sequences for d7bpkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bpkd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydsnkrpsgip drfsgsksgtsatlgitglqtgdeadyycgtwdsslsvwvfgggtklt
Timeline for d7bpkd_: