![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [317280] (7 PDB entries) |
![]() | Domain d7bpka2: 7bpk A:304-403 [401737] Other proteins in same PDB: d7bpka1, d7bpka3, d7bpkb1, d7bpkb3, d7bpkc_, d7bpkd_, d7bpkh_, d7bpkl_ automated match to d4gsxa2 mutant |
PDB Entry: 7bpk (more details), 3.1 Å
SCOPe Domain Sequences for d7bpka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bpka2 b.1.18.0 (A:304-403) automated matches {Zika virus [TaxId: 64320]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp vitestenskmmleldppfgdsyivigvgekkithhwhrs
Timeline for d7bpka2: