Lineage for d7bpka2 (7bpk A:304-403)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766609Species Zika virus [TaxId:64320] [317280] (7 PDB entries)
  8. 2766616Domain d7bpka2: 7bpk A:304-403 [401737]
    Other proteins in same PDB: d7bpka1, d7bpka3, d7bpkb1, d7bpkb3, d7bpkc_, d7bpkd_, d7bpkh_, d7bpkl_
    automated match to d4gsxa2
    mutant

Details for d7bpka2

PDB Entry: 7bpk (more details), 3.1 Å

PDB Description: zika virus envelope protein mutant bound to mab
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d7bpka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bpka2 b.1.18.0 (A:304-403) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrs

SCOPe Domain Coordinates for d7bpka2:

Click to download the PDB-style file with coordinates for d7bpka2.
(The format of our PDB-style files is described here.)

Timeline for d7bpka2: