Lineage for d7bpkl_ (7bpk L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758528Domain d7bpkl_: 7bpk L: [401821]
    Other proteins in same PDB: d7bpka1, d7bpka2, d7bpka3, d7bpkb1, d7bpkb2, d7bpkb3, d7bpkc_, d7bpkh_
    automated match to d5t93a_
    mutant

Details for d7bpkl_

PDB Entry: 7bpk (more details), 3.1 Å

PDB Description: zika virus envelope protein mutant bound to mab
PDB Compounds: (L:) IG c307_light_IGLV1-51_IGLJ2

SCOPe Domain Sequences for d7bpkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bpkl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydsnkrpsgip
drfsgsksgtsatlgitglqtgdeadyycgtwdsslsvwvfgggtklt

SCOPe Domain Coordinates for d7bpkl_:

Click to download the PDB-style file with coordinates for d7bpkl_.
(The format of our PDB-style files is described here.)

Timeline for d7bpkl_: