Lineage for d7bpkh_ (7bpk H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. 2743356Domain d7bpkh_: 7bpk H: [401910]
    Other proteins in same PDB: d7bpka1, d7bpka2, d7bpka3, d7bpkb1, d7bpkb2, d7bpkb3, d7bpkd_, d7bpkl_
    automated match to d1dqlh_
    mutant

Details for d7bpkh_

PDB Entry: 7bpk (more details), 3.1 Å

PDB Description: zika virus envelope protein mutant bound to mab
PDB Compounds: (H:) Z3L1 Heavy chain

SCOPe Domain Sequences for d7bpkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bpkh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg
tlvtvss

SCOPe Domain Coordinates for d7bpkh_:

Click to download the PDB-style file with coordinates for d7bpkh_.
(The format of our PDB-style files is described here.)

Timeline for d7bpkh_: