Lineage for d6vmkf_ (6vmk F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795529Protein Factor D [50563] (1 species)
  7. 2795530Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)
  8. 2795581Domain d6vmkf_: 6vmk F: [400740]
    Other proteins in same PDB: d6vmkb1, d6vmkb2, d6vmke1, d6vmke2, d6vmkh1, d6vmkh2, d6vmkj1, d6vmkj2, d6vmkk1, d6vmkk2, d6vmkl1, d6vmkl2, d6vmkn1, d6vmkn2, d6vmko1, d6vmko2, d6vmkq1, d6vmkq2, d6vmkr1, d6vmkr2, d6vmkt1, d6vmkt2, d6vmku1, d6vmku2, d6vmky1, d6vmky2, d6vmkz_
    automated match to d1bioa_
    complexed with gol, so4

Details for d6vmkf_

PDB Entry: 6vmk (more details), 3.01 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12
PDB Compounds: (F:) complement factor d

SCOPe Domain Sequences for d6vmkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmkf_ b.47.1.2 (F:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d6vmkf_:

Click to download the PDB-style file with coordinates for d6vmkf_.
(The format of our PDB-style files is described here.)

Timeline for d6vmkf_: