Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6vmko2: 6vmk O:107-213 [400813] Other proteins in same PDB: d6vmka_, d6vmkb1, d6vmkc_, d6vmkd_, d6vmke1, d6vmkf_, d6vmkg_, d6vmkh1, d6vmki_, d6vmkj1, d6vmkk1, d6vmkl1, d6vmkm_, d6vmkn1, d6vmko1, d6vmkp_, d6vmkq1, d6vmkr1, d6vmks_, d6vmkt1, d6vmku1, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky1, d6vmkz_ automated match to d1dn0a2 complexed with gol, so4 |
PDB Entry: 6vmk (more details), 3.01 Å
SCOPe Domain Sequences for d6vmko2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vmko2 b.1.1.2 (O:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d6vmko2:
View in 3D Domains from other chains: (mouse over for more information) d6vmka_, d6vmkb1, d6vmkb2, d6vmkc_, d6vmkd_, d6vmke1, d6vmke2, d6vmkf_, d6vmkg_, d6vmkh1, d6vmkh2, d6vmki_, d6vmkj1, d6vmkj2, d6vmkk1, d6vmkk2, d6vmkl1, d6vmkl2, d6vmkm_, d6vmkn1, d6vmkn2, d6vmkp_, d6vmkq1, d6vmkq2, d6vmkr1, d6vmkr2, d6vmks_, d6vmkt1, d6vmkt2, d6vmku1, d6vmku2, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky1, d6vmky2, d6vmkz_ |