SCOPe 2.08: Domain d6vmko2: 6vmk O:107-213

Lineage for d6vmko2 (6vmk O:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6vmko2: 6vmk O:107-213 [400813]
   Other proteins in same PDB: d6vmka_, d6vmkb1, d6vmkc_, d6vmkd_, d6vmke1, d6vmkf_, d6vmkg_, d6vmkh1, d6vmki_, d6vmkj1, d6vmkk1, d6vmkl1, d6vmkm_, d6vmkn1, d6vmko1, d6vmkp_, d6vmkq1, d6vmkr1, d6vmks_, d6vmkt1, d6vmku1, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky1, d6vmkz_
   automated match to d1dn0a2
   complexed with gol, so4

Details for d6vmko2

PDB Entry: 6vmk, 3.01 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12

PDB Compounds: (O:) Fab Y49R light chain

SCOPe Domain Sequences for d6vmko2:

Sequence; same for both SEQRES and ATOM records:

>d6vmko2 b.1.1.2 (O:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6vmko2:

• d6vmko2 first appeared in SCOPe 2.07