Lineage for d6vmkb1 (6vmk b:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759079Domain d6vmkb1: 6vmk b:1-106 [400785]
    Other proteins in same PDB: d6vmka_, d6vmkb2, d6vmkc_, d6vmkd_, d6vmke2, d6vmkf_, d6vmkg_, d6vmkh2, d6vmki_, d6vmkj2, d6vmkk2, d6vmkl2, d6vmkm_, d6vmkn2, d6vmko2, d6vmkp_, d6vmkq2, d6vmkr2, d6vmks_, d6vmkt2, d6vmku2, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky2
    automated match to d1dn0a1
    complexed with gol, so4

Details for d6vmkb1

PDB Entry: 6vmk (more details), 3.01 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12
PDB Compounds: (b:) Fab Y49R light chain

SCOPe Domain Sequences for d6vmkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmkb1 b.1.1.0 (b:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitckasqnvdtdvawfqqkpgkapkglirsassrysgvps
rfsgsgsgtdftltisslqpedfatyycqqynnypltfgqgtkvei

SCOPe Domain Coordinates for d6vmkb1:

Click to download the PDB-style file with coordinates for d6vmkb1.
(The format of our PDB-style files is described here.)

Timeline for d6vmkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6vmkb2