Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Factor D [50563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries) |
Domain d6vmkg_: 6vmk g: [400722] Other proteins in same PDB: d6vmkb1, d6vmkb2, d6vmke1, d6vmke2, d6vmkh1, d6vmkh2, d6vmkj1, d6vmkj2, d6vmkk1, d6vmkk2, d6vmkl1, d6vmkl2, d6vmkn1, d6vmkn2, d6vmko1, d6vmko2, d6vmkq1, d6vmkq2, d6vmkr1, d6vmkr2, d6vmkt1, d6vmkt2, d6vmku1, d6vmku2, d6vmky1, d6vmky2, d6vmkz_ automated match to d1bioa_ complexed with gol, so4 |
PDB Entry: 6vmk (more details), 3.01 Å
SCOPe Domain Sequences for d6vmkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vmkg_ b.47.1.2 (g:) Factor D {Human (Homo sapiens) [TaxId: 9606]} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d6vmkg_:
View in 3D Domains from other chains: (mouse over for more information) d6vmka_, d6vmkb1, d6vmkb2, d6vmkc_, d6vmkd_, d6vmke1, d6vmke2, d6vmkf_, d6vmkh1, d6vmkh2, d6vmki_, d6vmkj1, d6vmkj2, d6vmkk1, d6vmkk2, d6vmkl1, d6vmkl2, d6vmkm_, d6vmkn1, d6vmkn2, d6vmko1, d6vmko2, d6vmkp_, d6vmkq1, d6vmkq2, d6vmkr1, d6vmkr2, d6vmks_, d6vmkt1, d6vmkt2, d6vmku1, d6vmku2, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky1, d6vmky2, d6vmkz_ |