SCOPe 2.08: Domain d6vmkr1: 6vmk R:1-106

Lineage for d6vmkr1 (6vmk R:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6vmkr1: 6vmk R:1-106 [400905]
   Other proteins in same PDB: d6vmka_, d6vmkb2, d6vmkc_, d6vmkd_, d6vmke2, d6vmkf_, d6vmkg_, d6vmkh2, d6vmki_, d6vmkj2, d6vmkk2, d6vmkl2, d6vmkm_, d6vmkn2, d6vmko2, d6vmkp_, d6vmkq2, d6vmkr2, d6vmks_, d6vmkt2, d6vmku2, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky2
   automated match to d1dn0a1
   complexed with gol, so4

Details for d6vmkr1

PDB Entry: 6vmk, 3.01 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12

PDB Compounds: (R:) Fab Y49R light chain

SCOPe Domain Sequences for d6vmkr1:

Sequence; same for both SEQRES and ATOM records:

>d6vmkr1 b.1.1.0 (R:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitckasqnvdtdvawfqqkpgkapkglirsassrysgvps
rfsgsgsgtdftltisslqpedfatyycqqynnypltfgqgtkvei

Timeline for d6vmkr1:

• d6vmkr1 first appeared in SCOPe 2.07