Lineage for d1dn0a1 (1dn0 A:1-107)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. Domain d1dn0a1: 1dn0 A:1-107 [19830]
    Other proteins in same PDB: d1dn0a2, d1dn0b1, d1dn0b2, d1dn0c2, d1dn0d1, d1dn0d2
    part of Fab Kau cold agglutinin IgM

Details for d1dn0a1

PDB Entry: 1dn0 (more details), 2.2800000000000002 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin
PDB Compounds: (A:) igm-kappa cold agglutinin (light chain)

SCOPe Domain Sequences for d1dn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkvei

SCOPe Domain Coordinates for d1dn0a1 are not available.

Timeline for d1dn0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dn0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1dn0b1, d1dn0b2, d1dn0c1, d1dn0c2, d1dn0d1, d1dn0d2