Lineage for d6vmkk2 (6vmk k:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752186Domain d6vmkk2: 6vmk k:107-213 [400911]
    Other proteins in same PDB: d6vmka_, d6vmkb1, d6vmkc_, d6vmkd_, d6vmke1, d6vmkf_, d6vmkg_, d6vmkh1, d6vmki_, d6vmkj1, d6vmkk1, d6vmkl1, d6vmkm_, d6vmkn1, d6vmko1, d6vmkp_, d6vmkq1, d6vmkr1, d6vmks_, d6vmkt1, d6vmku1, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky1, d6vmkz_
    automated match to d1dn0a2
    complexed with gol, so4

Details for d6vmkk2

PDB Entry: 6vmk (more details), 3.01 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12
PDB Compounds: (k:) Fab Y49R light chain

SCOPe Domain Sequences for d6vmkk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmkk2 b.1.1.2 (k:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6vmkk2:

Click to download the PDB-style file with coordinates for d6vmkk2.
(The format of our PDB-style files is described here.)

Timeline for d6vmkk2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6vmkk1