Lineage for d1bioa_ (1bio A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795529Protein Factor D [50563] (1 species)
  7. 2795530Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)
  8. 2795532Domain d1bioa_: 1bio A: [26314]
    complexed with gol, soa

Details for d1bioa_

PDB Entry: 1bio (more details), 1.5 Å

PDB Description: human complement factor d in complex with isatoic anhydride inhibitor
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d1bioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d1bioa_:

Click to download the PDB-style file with coordinates for d1bioa_.
(The format of our PDB-style files is described here.)

Timeline for d1bioa_: