SCOPe 2.07: Domain d6m4wi1: 6m4w I:2021-2112

Lineage for d6m4wi1 (6m4w I:2021-2112)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)
   automatically mapped to Pfam PF08771

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)

6. Protein automated matches [193175] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries)

8. Domain d6m4wi1: 6m4w I:2021-2112 [391068]
   Other proteins in same PDB: d6m4wa_, d6m4wb_, d6m4wc_, d6m4wg2, d6m4wh2, d6m4wi2
   automated match to d2gaqa_
   complexed with gol, rap; mutant

Details for d6m4wi1

PDB Entry: 6m4w, 3.11 Å

PDB Description: crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin

PDB Compounds: (I:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d6m4wi1:

Sequence; same for both SEQRES and ATOM records:

>d6m4wi1 a.24.7.1 (I:2021-2112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme
aqewcrkymksgnvkdllqawdlyyhvfrris

Timeline for d6m4wi1:

• d6m4wi1 is new in SCOPe 2.07-stable
  
• d6m4wi1 appears in the current release, SCOPe 2.08