![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
![]() | Protein automated matches [190140] (38 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries) |
![]() | Domain d6m4wa_: 6m4w A: [391080] Other proteins in same PDB: d6m4wg1, d6m4wg2, d6m4wh1, d6m4wh2, d6m4wi1, d6m4wi2 automated match to d1a7la_ complexed with gol, rap; mutant |
PDB Entry: 6m4w (more details), 3.11 Å
SCOPe Domain Sequences for d6m4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m4wa_ c.94.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi ifwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynk dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydik dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsa vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde alkdaqtnaaamgvqvetispgdgrtfpkrgqtcvvhytgmle
Timeline for d6m4wa_: