![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() automatically mapped to Pfam PF08771 |
![]() | Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
![]() | Protein automated matches [193175] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries) |
![]() | Domain d6m4wh1: 6m4w H:2021-2112 [391112] Other proteins in same PDB: d6m4wa_, d6m4wb_, d6m4wc_, d6m4wg2, d6m4wh2, d6m4wi2 automated match to d2gaqa_ complexed with gol, rap; mutant |
PDB Entry: 6m4w (more details), 3.11 Å
SCOPe Domain Sequences for d6m4wh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m4wh1 a.24.7.1 (H:2021-2112) automated matches {Human (Homo sapiens) [TaxId: 9606]} ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme aqewcrkymksgnvkdllqawdlyyhvfrris
Timeline for d6m4wh1: