Lineage for d6m4wg1 (6m4w G:2021-2112)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313347Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
    automatically mapped to Pfam PF08771
  5. 2313348Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)
  6. 2313365Protein automated matches [193175] (1 species)
    not a true protein
  7. 2313366Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries)
  8. 2313375Domain d6m4wg1: 6m4w G:2021-2112 [391073]
    Other proteins in same PDB: d6m4wa_, d6m4wb_, d6m4wc_, d6m4wg2, d6m4wh2, d6m4wi2
    automated match to d2gaqa_
    complexed with gol, rap; mutant

Details for d6m4wg1

PDB Entry: 6m4w (more details), 3.11 Å

PDB Description: crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin
PDB Compounds: (G:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d6m4wg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m4wg1 a.24.7.1 (G:2021-2112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme
aqewcrkymksgnvkdllqawdlyyhvfrris

SCOPe Domain Coordinates for d6m4wg1:

Click to download the PDB-style file with coordinates for d6m4wg1.
(The format of our PDB-style files is described here.)

Timeline for d6m4wg1: