Lineage for d6m4wb_ (6m4w B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522155Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries)
  8. 2522206Domain d6m4wb_: 6m4w B: [391089]
    Other proteins in same PDB: d6m4wg1, d6m4wg2, d6m4wh1, d6m4wh2, d6m4wi1, d6m4wi2
    automated match to d1a7la_
    complexed with gol, rap; mutant

Details for d6m4wb_

PDB Entry: 6m4w (more details), 3.11 Å

PDB Description: crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin
PDB Compounds: (B:) chimera of Maltose/maltodextrin-binding periplasmic protein and Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d6m4wb_:

Sequence, based on SEQRES records: (download)

>d6m4wb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif
wahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkdl
lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikdv
gvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsavn
ygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplga
valksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdeal
kdaqtnaaamgvqvetispgdgrtfpkrgqtcvvhytgmle

Sequence, based on observed residues (ATOM records): (download)

>d6m4wb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif
wahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkdl
lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkygkydikdvgv
dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsavnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
aqtnaaamgvqvetispgdgrtfpkrgqtcvvhytgmle

SCOPe Domain Coordinates for d6m4wb_:

Click to download the PDB-style file with coordinates for d6m4wb_.
(The format of our PDB-style files is described here.)

Timeline for d6m4wb_: