SCOPe 2.08: Domain d6h6ke1: 6h6k E:2-206

Lineage for d6h6ke1 (6h6k E:2-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [256083] (13 PDB entries)

8. Domain d6h6ke1: 6h6k E:2-206 [367767]
   Other proteins in same PDB: d6h6ka2, d6h6ka3, d6h6kb2, d6h6kb3, d6h6kc2, d6h6kc3, d6h6kd2, d6h6kd3, d6h6ke2, d6h6ke3
   automated match to d2qn6a3
   complexed with edo, gcp, na; mutant

Details for d6h6ke1

PDB Entry: 6h6k, 2 Å

PDB Description: the structure of the fkr mutant of the archaeal translation initiation factor 2 gamma subunit in complex with gdpcp, obtained in the absence of magnesium salts in the crystallization solution.

PDB Compounds: (E:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6h6ke1:

Sequence, based on SEQRES records:

>d6h6ke1 c.37.1.8 (E:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records):

>d6h6ke1 c.37.1.8 (E:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtsmtiklgyaetnigvcesckkpeayvt
epsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtr
ehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkin
idsliegieeyiktpy

Timeline for d6h6ke1:

• d6h6ke1 first appeared in SCOPe 2.07