Lineage for d2qn6a3 (2qn6 A:2-206)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (81 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
Uniprot Q980A5 2-206
Domain d2qn6a3: 2qn6 A:2-206 [150913]
Other proteins in same PDB: d2qn6a1, d2qn6a2, d2qn6b_
automated match to d2ahoa3
complexed with gdp, mg
Details for d2qn6a3
PDB Entry: 2qn6 (more details), 2.15 Å
PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (A:) Translation initiation factor 2 gamma subunitSCOPe Domain Sequences for d2qn6a3:
Sequence, based on SEQRES records: (download)
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy
Sequence, based on observed residues (ATOM records): (download)
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtlgyaetnigvcesckkpeayvtepsck
scgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtrehfva
lgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinidsli
egieeyiktpy
SCOPe Domain Coordinates for d2qn6a3:
Click to download the PDB-style file with coordinates for d2qn6a3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qn6a3:
- d2qn6a3 first appeared in SCOP 1.75
- d2qn6a3 appears in SCOPe 2.07
View in 3D
