SCOPe 2.08: Domain d2qn6b_: 2qn6 B:

Lineage for d2qn6b_ (2qn6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family)

5. Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)

6. Protein eIF-2-alpha, C-terminal domain [110995] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
   Uniprot Q97Z79 176-264

8. Domain d2qn6b_: 2qn6 B: [150914]
   Other proteins in same PDB: d2qn6a1, d2qn6a2, d2qn6a3
   automated match to d2qn6b1
   complexed with gdp, mg

Details for d2qn6b_

PDB Entry: 2qn6, 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states

PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2qn6b_:

Sequence; same for both SEQRES and ATOM records:

>d2qn6b_ d.58.51.1 (B:) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvvk

Timeline for d2qn6b_:

• d2qn6b_ first appeared in SCOP 1.75, called d2qn6b1
  
• d2qn6b_ appears in SCOPe 2.07