Lineage for d2qn6b_ (2qn6 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522526Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 2522527Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 2522528Protein eIF-2-alpha, C-terminal domain [110995] (2 species)
  7. 2522531Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
    Uniprot Q97Z79 176-264
  8. 2522532Domain d2qn6b_: 2qn6 B: [150914]
    Other proteins in same PDB: d2qn6a1, d2qn6a2, d2qn6a3
    automated match to d2qn6b1
    complexed with gdp, mg

Details for d2qn6b_

PDB Entry: 2qn6 (more details), 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2qn6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qn6b_ d.58.51.1 (B:) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvvk

SCOPe Domain Coordinates for d2qn6b_:

Click to download the PDB-style file with coordinates for d2qn6b_.
(The format of our PDB-style files is described here.)

Timeline for d2qn6b_: