![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
![]() | Protein Initiation factor eIF2 gamma subunit [74964] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries) Uniprot Q980A5 321-415 |
![]() | Domain d2qn6a2: 2qn6 A:321-415 [150912] Other proteins in same PDB: d2qn6a1, d2qn6a3, d2qn6b_ automated match to d2ahoa2 complexed with gdp, mg |
PDB Entry: 2qn6 (more details), 2.15 Å
SCOPe Domain Sequences for d2qn6a2:
Sequence, based on SEQRES records: (download)
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvvdpiraketlmlsvgssttlgivtsvkkdeievelrrpva vwsnnirtvisrqiagrwrmigwglvei
Timeline for d2qn6a2: