Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [256085] (13 PDB entries) |
Domain d6h6ke3: 6h6k E:321-415 [367769] Other proteins in same PDB: d6h6ka1, d6h6ka2, d6h6kb1, d6h6kb2, d6h6kc1, d6h6kc2, d6h6kd1, d6h6kd2, d6h6ke1, d6h6ke2 automated match to d4m53a3 complexed with edo, gcp, na; mutant |
PDB Entry: 6h6k (more details), 2 Å
SCOPe Domain Sequences for d6h6ke3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h6ke3 b.44.1.0 (E:321-415) automated matches {Sulfolobus solfataricus [TaxId: 273057]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d6h6ke3: