Lineage for d6h6ke3 (6h6k E:321-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794055Species Sulfolobus solfataricus [TaxId:273057] [256085] (13 PDB entries)
  8. 2794070Domain d6h6ke3: 6h6k E:321-415 [367769]
    Other proteins in same PDB: d6h6ka1, d6h6ka2, d6h6kb1, d6h6kb2, d6h6kc1, d6h6kc2, d6h6kd1, d6h6kd2, d6h6ke1, d6h6ke2
    automated match to d4m53a3
    complexed with edo, gcp, na; mutant

Details for d6h6ke3

PDB Entry: 6h6k (more details), 2 Å

PDB Description: the structure of the fkr mutant of the archaeal translation initiation factor 2 gamma subunit in complex with gdpcp, obtained in the absence of magnesium salts in the crystallization solution.
PDB Compounds: (E:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6h6ke3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6ke3 b.44.1.0 (E:321-415) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d6h6ke3:

Click to download the PDB-style file with coordinates for d6h6ke3.
(The format of our PDB-style files is described here.)

Timeline for d6h6ke3: